PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00861.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 435aa    MW: 48303 Da    PI: 8.4579
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00861.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.3e-39106166262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrk+k+ss
  Rsa1.0_00861.1_g00002.1 106 PTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKHKSSS 166
                              67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-28103158IPR003851Zinc finger, Dof-type
PfamPF027016.3E-32108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.435110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MMMESRDPAI KLFGMKIPFP AVFEQPLTVA VVEEEHTGGD DKSLEKVTTE QVTPELSEKK  60
NNCNNNNNLN DSKPETGDKE EEATSTDDQT ESDQQTTEDG KTLKKPTKIL PCPRCKSMDT  120
KFCYYNNYNI NQPRHFCKAC QRYWTAGGTM RNVPVGAGRR KHKSSSSHYR HITISEALQA  180
ARLDPGLQSN TRVLSFGLQA HQQHAAPITP VMKLQGDQKV QNGARNGLAD QRVENGDDCS  240
SGSSVTTTSV DETRAQNCRV VEPQMNSNNN MNGYACIPGV PWPYTWNPAM PPPGFYPPPG  300
YPMPFYPYWT IPMLPPNQSS SPISQKGWSP NSPTLGKHSR DEEPSRKGDE TERKQRNGRV  360
IVPKTLRIDD PDEAAKSSIW TTLGIKNEGS RLGSKGGGMF KGFDQKTKKS NNENPPLLSA  420
NPAALSRSLN FQERV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4513120.0GU451312.1 Brassica napus putative dof zinc finger protein (dof1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630222.10.0PREDICTED: cyclic dof factor 3
SwissprotQ8LFV30.0CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A0D3BHU30.0A0A0D3BHU3_BRAOL; Uncharacterized protein
STRINGBra018141.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.10.0cycling DOF factor 3